Skip to main content

Table 1 Retrieved FASTA sequences

From: An immunoinformatics study: designing multivalent T-cell epitope vaccine against canine circovirus

>QFU80922.1 replicase [Canine circovirus]
MAQAQVDQRGRDSRRGNPVRRWCFTINNPTPEEEEAVKNLAPDAKYLICGREVGENGTPHLQGFVNLKKTTRMGALKARLGGRGHFEPARGDDCSNKDYCSKGGDILIESGEVSRQGKRNDLHDAVEKLRETKSLAAVAAAYPETYVKFSRGLRELLLISPEMTTPRNWKTEVEVLCGPPGCGKSRYCMETAPDAYWKPRGKWWDGYDGHQDVILDDFYGWLPFDDMLRLCDRYPLRVETKGGTMNFVARRVFITSNRLPHEWYSDEIGNKDALYRRLTLIKVWDGGNFIPVPHFMFPHMYNY
>QBQ20241.1 capsid Protein [Canine circovirus]
MRVRRHARASRRSYRTRPLNRYRRRRQNRFKLFHLRLRRTLTADWPTAPVKPTNDPQTETPLLWNFDHLSFKLTDFLQTSHGTGDYQHLPPFRFFKFKKVYIRAKWINWPRTLMENVLGRTALDLDGEDQGRGNAQRSHLDPGCVPGRLEPPKDPNKAPFIYDPLQDRSSSRSFNMASGFKRGLTPKPMFTQDITSPSATAPWLTRGTPWVSVIQGANMVWNGLSISLRQMKDMRPTTPDTSTSQIPQVQYDISAYIAFKEFDYETGRQL