Fig. 5

The position of biotechnologically potential genes on the HI03-3b genome map. A Certain loci encoding biotechnologically potential enzymes and secondary metabolite biosynthesis were determined based on PROKSEE analysis on the CGView Server [58, 59]. B Natural product BGCs were identified in the HI03-3b genome sequence based on antiSMASH analysis [7] supported by BLASTx [2], showing the presence of core and additional biosynthetic genes, transport-related genes, regulatory genes, and other genes. The core biosynthetic genes of RiPP-like terpene BGC (from left to right) are predicted to code for squalene-hopene cyclase, leader peptide (SagB-type dehydrogenase domain), YcaO cyclodehydratase, and thiazole-containing bacteriocin maturation protein. PKS type III BGC contains a chalcone synthase gene (indicated by red colour) as the core biosynthetic gene. The siderophore BGC harbours the core biosynthetic genes encoding lucA/lucC family proteins. Based on RiPPMiner prediction [1] the core lassopeptide BGC encodes a precursor peptide that consists of a leader (VKAPGSTGEGHWKLGNLSAEEKSGIPRVAVKCVEMWRNTSGE) and core peptide sequence (GDSLVCN). A crosslink may occur between serine (S) and cysteine (C) residues in the core peptide [1]. Note: PKS, polyketide synthase; BGC, biosynthetic gene cluster; RiPP, ribosomally synthesized and post-translationally modified peptides