Skip to main content

Table 1 List of potential immunogenic epitopes of the putative OMPs of Mtb

From: Computational identification of significant immunogenic epitopes of the putative outer membrane proteins from Mycobacterium tuberculosis

S. No Putative OMPs of Mtb B cell epitopes T cell prediction VaxiJen Score AlgPred Score Percentage identity to human proteome
Start End Sequence MHC Class I MHC Class II    
1. Rv0172a 382 432 ASTASTLPKEIAYSEPRLQPPNGYKDTTVPGIWVPDTPLSHRNTQPGWVVA 27 27 0.5031 − 0.79612523 No significant similarity found
2 Rv0257 21 52 GLRGSLPGDSGGTAPDSHRLPASSSPDGKNIG 19 0 0.778 − 0.49379 No significant similarity found
3 Rv0295ca 228 264 AIGQDPKLAPAPMLERQANQRSDEWVDRYRAEAPRLG 26 27 0.8884 − 1.24481 No significant similarity found
4 Rv0506 125 137 VKDERSETSPRAL 6 2 1.3782 − 0.7865 61.11%
5 Rv1006a 24 59 LNGCSSSASHRGPLNAMGSPAIPSTAQEIPNPLRGQ 26 27 0.4214 − 0.76213 No significant similarity found
6 Rv1351 1 34 MTPRSLPRYGNSSRRKSFPMHRPSNVATATRKKS 24 23 0.6134 − 0.79832 28.12%
7 Rv1477 238 269 SSEGGQGAPPFRMWDPGSGPAGGRAWDGLWDP 22 12 1.189 − 0.54733094 52.63%
8 Rv1478 211 230 MLEASGSAGKVTVSPVRKAG 18 10 0.9246 − 0.72966 57.89%
9 Rv1488 312 343 GKPGEDGVFRFEPSPVEDQPKHAADGDDAEVA 21 27 1.1083 − 0.42041 41.67%
10. Rv1906c 110 135 CQPWQNTGSEGAAPAGVPGPEAGAQL 18 17 0.8377 − 0.4423 68.42%
11 Rv1910c 28 60 YGGNGDSRKAAPLAPKAAALGRSMPETPTGDVL 22 22 0.726 − 1.35881 42.86%
12 Rv2075c 392 403 SWAPDEPRAGAG 5 1 1.2283 − 0.62431 58.82%
13 Rv2112c 184 204 VTGSGRVGIGPSGDEPGFQLS 9 3 1.5556 − 0.41539 64.29%
14. Rv2232 1 40 MSSPRERRPASQAPRLSRRPPAHQTSRSSPDTTAPTGSGL 24 5 0.7629 − 0.52367 No significant similarity found
  49 79 GIVTDTTASGTNCPPPPRAAARRASSPGESP 17 10 0.6672 − 0.73783 No significant similarity found
15. Rv2264ca 383 425 AWSEADEDSHIGPAPGYTAARPSLSFDHDAHAEPEPKSPPIPW 27 27 0.7743 − 1.00823 52.17%
16 Rv2307c 115 135 GYGGNPGRPSEQGLAADARAA 12 2 0.9422 − 0.7492 64.71%
17 Rv2525ca 102 153 YGKGSTADWLGGASAGVQHARRGSELHAAAGGPTSAPIYASIDDNPSYEQYK 27 27 0.9026 − 0.48836 No significant similarity found
18 Rv2672 33 72 AFGADPRFATYSGAGPQGAATTTPPPAGPPPLAAPKNDLS 21 27 0.7615 − 0.65308 69.23%
19 Rv2891 33 52 PAHADDSRLGWPLRPPPAVV 21 4 1.2467 − 0.64531 75%
20. Rv2956 199 247 AGALAGAGHRKSPKQGVFRGAAQGGDIVARQPPGRWVCPSSAGGPIGWH 22 25 0.4568 − 0.96573 36.59%
21. Rv2980 33 55 NRQPPERPVVIPAVPAPQATGPG 16 27 0.5001 − 0.44976 68.75%
  68 93 GEYRRAPVAEPTTAGATAWRTGPNST 23 21 0.7059 − 0.75355 57.14%
22. Rv3096 134 168 DPLPRPGRQRAPRAGVHNSGWVQSPGAERLDDRRY 24 11 0.4054 − 0.40957 No significant similarity found
23 Rv3212 1 13 MVKPERRTKTDIA 7 0 0.5383 − 0.47334 64.29%
24.   188 199 DARVKPSNRGLQ 4 2 1.3432 − 0.56986 66.67%
25. Rv3484 358 380 AFGSAPPTSQTAAAAKPNPSTVV 17 13 0.6267 − 0.41964 62.5%
26. Rv3492c 354 381 KTAQNDPSTVRGARNYPCQEFPGKRAPT 26 6 0.7796 − 0.48815 72.73%
  529 552 GAFADPAGGTGIFAPGMTGASSAE 21 15 0.5891 − 0.45661 71.43%
27. Rv3587c 43 116 SSAGAKPVSADKPASAQSHPGSPAPQAPQPAGQTEGNAAAAPPQGQNPETPTPTAAVQPPPVLKEGDDCPDSTL 22 27 0.7745 − 0.76176 40.38%
28. Rv3693 242 258 RVGVDPTAADPAGWPRL 17 0 0.5311 − 0.64804 75%
29. Rv3796 139 182 LAPPGRAPVLVYGPGPAGGLPPSEVGNPNPATVNPANPTPGLAA 23 27 0.5826 − 0.45843 61.9%
30. Rv3909 374 388 STRGATVLPDGPLTG 12 2 0.5078 − 0.43926 66.67%
  1. aSelected IDEs