Computational identification of significant immunogenic epitopes of the putative outer membrane proteins from Mycobacterium tuberculosis

Sundar, Shobana; Thangamani, Lokesh; Piramanayagam, Shanmughavel

doi:10.1186/s43141-021-00148-9

Journal of Genetic Engineering and Biotechnology

Table 1 List of potential immunogenic epitopes of the putative OMPs of Mtb

From: Computational identification of significant immunogenic epitopes of the putative outer membrane proteins from Mycobacterium tuberculosis

S. No	Putative OMPs of Mtb	B cell epitopes			T cell prediction		VaxiJen Score	AlgPred Score	Percentage identity to human proteome
S. No	Putative OMPs of Mtb	Start	End	Sequence	MHC Class I	MHC Class II
1.	Rv0172^a	382	432	ASTASTLPKEIAYSEPRLQPPNGYKDTTVPGIWVPDTPLSHRNTQPGWVVA	27	27	0.5031	− 0.79612523	No significant similarity found
2	Rv0257	21	52	GLRGSLPGDSGGTAPDSHRLPASSSPDGKNIG	19	0	0.778	− 0.49379	No significant similarity found
3	Rv0295c^a	228	264	AIGQDPKLAPAPMLERQANQRSDEWVDRYRAEAPRLG	26	27	0.8884	− 1.24481	No significant similarity found
4	Rv0506	125	137	VKDERSETSPRAL	6	2	1.3782	− 0.7865	61.11%
5	Rv1006^a	24	59	LNGCSSSASHRGPLNAMGSPAIPSTAQEIPNPLRGQ	26	27	0.4214	− 0.76213	No significant similarity found
6	Rv1351	1	34	MTPRSLPRYGNSSRRKSFPMHRPSNVATATRKKS	24	23	0.6134	− 0.79832	28.12%
7	Rv1477	238	269	SSEGGQGAPPFRMWDPGSGPAGGRAWDGLWDP	22	12	1.189	− 0.54733094	52.63%
8	Rv1478	211	230	MLEASGSAGKVTVSPVRKAG	18	10	0.9246	− 0.72966	57.89%
9	Rv1488	312	343	GKPGEDGVFRFEPSPVEDQPKHAADGDDAEVA	21	27	1.1083	− 0.42041	41.67%
10.	Rv1906c	110	135	CQPWQNTGSEGAAPAGVPGPEAGAQL	18	17	0.8377	− 0.4423	68.42%
11	Rv1910c	28	60	YGGNGDSRKAAPLAPKAAALGRSMPETPTGDVL	22	22	0.726	− 1.35881	42.86%
12	Rv2075c	392	403	SWAPDEPRAGAG	5	1	1.2283	− 0.62431	58.82%
13	Rv2112c	184	204	VTGSGRVGIGPSGDEPGFQLS	9	3	1.5556	− 0.41539	64.29%
14.	Rv2232	1	40	MSSPRERRPASQAPRLSRRPPAHQTSRSSPDTTAPTGSGL	24	5	0.7629	− 0.52367	No significant similarity found
14.		49	79	GIVTDTTASGTNCPPPPRAAARRASSPGESP	17	10	0.6672	− 0.73783	No significant similarity found
15.	Rv2264c^a	383	425	AWSEADEDSHIGPAPGYTAARPSLSFDHDAHAEPEPKSPPIPW	27	27	0.7743	− 1.00823	52.17%
16	Rv2307c	115	135	GYGGNPGRPSEQGLAADARAA	12	2	0.9422	− 0.7492	64.71%
17	Rv2525c^a	102	153	YGKGSTADWLGGASAGVQHARRGSELHAAAGGPTSAPIYASIDDNPSYEQYK	27	27	0.9026	− 0.48836	No significant similarity found
18	Rv2672	33	72	AFGADPRFATYSGAGPQGAATTTPPPAGPPPLAAPKNDLS	21	27	0.7615	− 0.65308	69.23%
19	Rv2891	33	52	PAHADDSRLGWPLRPPPAVV	21	4	1.2467	− 0.64531	75%
20.	Rv2956	199	247	AGALAGAGHRKSPKQGVFRGAAQGGDIVARQPPGRWVCPSSAGGPIGWH	22	25	0.4568	− 0.96573	36.59%
21.	Rv2980	33	55	NRQPPERPVVIPAVPAPQATGPG	16	27	0.5001	− 0.44976	68.75%
21.		68	93	GEYRRAPVAEPTTAGATAWRTGPNST	23	21	0.7059	− 0.75355	57.14%
22.	Rv3096	134	168	DPLPRPGRQRAPRAGVHNSGWVQSPGAERLDDRRY	24	11	0.4054	− 0.40957	No significant similarity found
23	Rv3212	1	13	MVKPERRTKTDIA	7	0	0.5383	− 0.47334	64.29%
24.		188	199	DARVKPSNRGLQ	4	2	1.3432	− 0.56986	66.67%
25.	Rv3484	358	380	AFGSAPPTSQTAAAAKPNPSTVV	17	13	0.6267	− 0.41964	62.5%
26.	Rv3492c	354	381	KTAQNDPSTVRGARNYPCQEFPGKRAPT	26	6	0.7796	− 0.48815	72.73%
26.		529	552	GAFADPAGGTGIFAPGMTGASSAE	21	15	0.5891	− 0.45661	71.43%
27.	Rv3587c	43	116	SSAGAKPVSADKPASAQSHPGSPAPQAPQPAGQTEGNAAAAPPQGQNPETPTPTAAVQPPPVLKEGDDCPDSTL	22	27	0.7745	− 0.76176	40.38%
28.	Rv3693	242	258	RVGVDPTAADPAGWPRL	17	0	0.5311	− 0.64804	75%
29.	Rv3796	139	182	LAPPGRAPVLVYGPGPAGGLPPSEVGNPNPATVNPANPTPGLAA	23	27	0.5826	− 0.45843	61.9%
30.	Rv3909	374	388	STRGATVLPDGPLTG	12	2	0.5078	− 0.43926	66.67%

^aSelected IDEs

Back to article page