Skip to main content

Table 5 Peptide matching of S.AMP13 with alkaline metalloprotease from Pseudomonas syringae pv.maculicola (Accession no. KPB92383.1)

From: Purification, characterization, and structural elucidation of serralysin-like alkaline metalloprotease from a novel source

Positions Peptide sequence Peptide M.W (Da)
3–31 VKENAAIQLSAATSTSFDQINTFAHEYDR 3227.56
5–54 ENAAIQLSAATSTSFDQINTFAHEYDRGGNLTINGKPSYSVDQAANFILR 5416.647
55–97 DDAAWADRDGNGTINLTYTFLTAKPAGFNNALGTFSAFNAQQK 4593.207
205–213 DATYAEDTR 1041.448
233–251 GGAPSYSSAPLLDDIAAVQQLYGANLSTR 2935.48
262–275 ATDTVYGFNSTAGR 1459.681
\